Accéder au contenu
Merck
Toutes les photos(6)

Key Documents

HPA005482

Sigma-Aldrich

Anti-IL17RB antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-Cytokine receptor CRL4, Anti-IL-17 receptor B, Anti-IL-17 receptor homolog 1, Anti-IL-17B receptor, Anti-IL-17RB, Anti-IL-17Rh1, Anti-IL17Rh1, Anti-Interleukin-17 receptor B precursor, Anti-Interleukin-17B receptor

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Technique(s)

immunohistochemistry: 1:50-1:200

Séquence immunogène

QCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPG

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... IL17RB(55540)

Description générale

Interleukin 17 receptor B (IL17RB) is a member of the IL-17 receptor (IL17R) family. It makes a heterodimeric receptor complex along with IL17RA. This family of proteins has a single transmembrane domain, which contains fibronectin type-III (FnIII) domain. They have an extracellular domain and a cytosolic domain which contains the unique SEFIR [SEF (similar expression to fibroblast growth factor genes) and IL-17R] domain. IL17RB acts as a receptor for IL17B as well as IL17E. In humans, this gene is located on chromosome 3p21.1. The molecular weight of IL17RB is 56kDa. It is expressed on lung fibroblasts, basophils along with CD4+ Th2 memory cells.

Immunogène

Interleukin-17 receptor B precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-IL17RB antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Actions biochimiques/physiologiques

Interleukin 17 receptor B (IL17RB) expression is induced by Th2 cytokines, in antigen presenting cells. Induction of IL17RB leads to inflammatory responses via activation of Jun kinase (JNK), nuclear factor-κB and p38 mitogen-activated protein kinase (MAPK). Therefore, polymorphisms in this gene are associated with asthma, and can be used as markers to determine the risk of developing asthma. Studies suggest that IL17RB is the only gene, whose transcription varies in accordance with the IgE levels in asthmatics. Exposure to natural allergens leads to elevated levels of IL17RB in patients with seasonal allergic rhinitis (SAR). Blocking of this protein prevents lung inflammation and thus, IL17RB can be a potential therapeutic target for allergies.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST86465

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Yuri Matsumoto et al.
Allergology international : official journal of the Japanese Society of Allergology, 60(1), 87-92 (2011-01-22)
Seasonal allergic rhinitis (SAR) to Japanese cedar (Cryptomeria japonica; JC) is an IgE-mediated type I allergy affecting the nasal mucosa. However, the molecular mechanisms that underlie SAR are only partially understood. The aim of the study was to identify novel
Ji-Sun Jung et al.
Chest, 135(5), 1173-1180 (2009-01-02)
Interleukin (IL)-17E is a member of the IL-17 family, which induces IL-4, IL-5, IL-13, and eotaxin in experimental animals via IL-17 receptor B (IL-17RB). The activation of IL-17RB amplifies allergic-type inflammatory responses by inducing Jun kinase (or JNK), p38 mitogen-activated
Bing Zhang et al.
Journal of immunology (Baltimore, Md. : 1950), 190(5), 2320-2326 (2013-01-29)
IL-17 cytokines play a crucial role in a variety of inflammatory and autoimmune diseases. They signal through heterodimeric receptor complexes consisting of members of IL-17R family. A unique intracellular signaling domain was identified within all IL-17Rs, termed similar expression to
Gary M Hunninghake et al.
BMC pulmonary medicine, 11, 17-17 (2011-04-09)
The relationships between total serum IgE levels and gene expression patterns in peripheral blood CD4+ T cells (in all subjects and within each sex specifically) are not known. Peripheral blood CD4+ T cells from 223 participants from the Childhood Asthma
Chiaki Ono et al.
PloS one, 9(11), e111405-e111405 (2014-11-08)
Peripheral blood samples have been subjected to comprehensive gene expression profiling to identify biomarkers for a wide range of diseases. However, blood samples include red blood cells, white blood cells, and platelets. White blood cells comprise polymorphonuclear leukocytes, monocytes, and

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique