Accéder au contenu
Merck
Toutes les photos(2)

Documents

AV53693

Sigma-Aldrich

Anti-HSPA4L antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-APG-1, Anti-Heat shock 70 kDa protein 4-like, Anti-Osp94

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

95 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_055093

Numéro d'accès UniProt

O95757

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... HSPA4L(22824)

Description générale

Heat shock 70kDa protein 4L is a protein encoded by the HSPA4L gene in humans. Heat shock proteins HSPA4L and HSPA4 are closely related members of the HSP110 family and act as cochaperones.

Immunogène

Synthetic peptide directed towards the C terminal region of human HSPA4L

Application

Anti-HSPA4L antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/mL.

Actions biochimiques/physiologiques

Hspa4l is expressed ubiquitously and predominantly in the testis and is highly expressed in spermatogenic cells. It plays an important role in osmotolerance. HSPA4L and HSPA4 collaborate in embryonic lung maturation and helps in air breathing during child birth. Osp94 also acts as molecular chaperone and possesses cytoprotective role from excessive stimulation from heat, hyper-ionic and osmotic stress which cause marked perturbation of intracellular protein function including the suppression of protein synthesis.

Séquence

Synthetic peptide located within the following region: KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

H Yamamoto et al.
Neuroscience, 158(4), 1691-1698 (2008-12-09)
Osmotic stress protein 94 (OSP94), a member of the heat shock protein 110/SSE subfamily, is expressed in certain organs such as the kidney, testis, and brain where it can act as a molecular chaperon. In general, its alteration in expression
Belal A Mohamed et al.
American journal of respiratory cell and molecular biology, 50(4), 817-824 (2013-08-29)
Heat shock proteins HSPA4L and HSPA4 are closely related members of the HSP110 family and act as cochaperones. We generated Hspa4l(-/-)Hspa4(-/-) mice to investigate a functional complementarity between HSPA4L and HSPA4 during embryonic development. Hspa4l(-/-)Hspa4(-/-) embryos exhibited marked pulmonary hypoplasia
Torsten Held et al.
Molecular and cellular biology, 26(21), 8099-8108 (2006-08-23)
The Hspa4l gene, also known as Apg1 or Osp94, belongs to the HSP110 heat shock gene family, which includes three genes encoding highly conserved proteins. This study shows that Hspa4l is expressed ubiquitously and predominantly in the testis. The protein

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique