Accéder au contenu
Merck
Toutes les photos(1)

Documents

AV50821

Sigma-Aldrich

Anti-LIN9 (AB2) antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-BARA, Anti-BARPsv, Anti-Lin-9, Anti-Lin-9 homolog (C. elegans), Anti-TGS, Anti-TGS1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

53 kDa

Espèces réactives

guinea pig, horse, mouse, bovine, dog, human, rat, rabbit

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_775106

Numéro d'accès UniProt

B1B046

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... LIN9(286826)

Immunogène

Synthetic peptide directed towards the N terminal region of human LIN9

Application

Anti-LIN9 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.

Actions biochimiques/physiologiques

Lin-9 homolog (C. elegans) is a tumor suppressor that associates with retinoblastoma 1 protein and inhibits DNA synthesis and regulates cell cycle and cell cycle-dependent gene expression. LIN9 is a subunit of DREAM complex and regulates gene expression and proliferation of embryonic stem cells.

Séquence

Synthetic peptide located within the following region: TRKLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVA

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Nina Reichert et al.
Molecular and cellular biology, 30(12), 2896-2908 (2010-04-21)
The retinoblastoma tumor suppressor protein (pRB) and related p107 and p130 "pocket proteins" function together with the E2F transcription factors to repress gene expression during the cell cycle and development. Recent biochemical studies have identified the multisubunit DREAM pocket protein
Jasmina Esterlechner et al.
PloS one, 8(5), e62882-e62882 (2013-05-15)
The DREAM complex plays an important role in regulation of gene expression during the cell cycle. We have previously shown that the DREAM subunit LIN9 is required for early embryonic development and for the maintenance of the inner cell mass

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique