Accéder au contenu
Merck
Toutes les photos(1)

Documents

AV48240

Sigma-Aldrich

Anti-DRG1 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-Developmentally regulated GTP binding protein 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

26 kDa

Espèces réactives

horse, human, rabbit, dog, guinea pig, rat, bovine, mouse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... DRG1(4733)

Description générale

Developmentally regulated GTP binding protein 1 (DRG1) is a a guanine nucleotide binding protein that functions as a potassium-dependent GTPase. It is upregulated by Lerepo4.
Rabbit Anti-DRG1 antibody recognizes human, mouse, rat, bovine, zebrafish, chicken, and rabbit DRG1.

Immunogène

Synthetic peptide directed towards the middle region of human DRG1

Application

Rabbit Anti-DRG1 antibody is suitable for western blot applications at a concentration of 1μg/ml.

Actions biochimiques/physiologiques

DRG1 belongs to the GTP1/OBG family.It may play a role in cell proliferation, differentiation and death.

Séquence

Synthetic peptide located within the following region: VLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSEL

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Isabel Pérez-Arellano et al.
The FEBS journal, 280(15), 3647-3657 (2013-05-29)
Human Drg1, a guanine nucleotide binding protein conserved in archaea and eukaryotes, is regulated by Lerepo4. Together they form a complex which interacts with translating ribosomes. Here we have purified and characterized the GTPase activity of Drg1 and three variants

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique