Accéder au contenu
Merck
Toutes les photos(1)

Documents

AV48212

Sigma-Aldrich

Anti-PEBP1 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-HCNP, Anti-PBP, Anti-PEBP, Anti-Phosphatidylethanolamine binding protein 1, Anti-RKIP

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

21 kDa

Espèces réactives

mouse, bovine, rat, guinea pig, horse, human, rabbit

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_002558

Numéro d'accès UniProt

P30086

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PEBP1(5037)

Description générale

PEBP1 is a phosphatidylethanolamine binding protein that interacts with nucleotides and Raf-1 peptides. Studies in rat have revealed that PEBP1 is downregulated during hypoxia.
Rabbit Anti-PEBP1 antibody recognizes human, mouse, chicken, canine, bovine, and rabbit PEBP1.

Immunogène

Synthetic peptide directed towards the C terminal region of human PEBP1

Application

Rabbit Anti-PEBP1 antibody is suitable for western blot applications at a concentration of 1.25μg/ml.

Actions biochimiques/physiologiques

PEBP1 binds ATP, opioids and phosphatidylethanolamine. It has lower affinity for phosphatidylinositol and phosphatidylcholine. It is also a serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase.

Séquence

Synthetic peptide located within the following region: LSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Sandeepta Burgula et al.
Journal of molecular neuroscience : MN, 41(1), 36-47 (2009-08-26)
In order to understand dementia and other ailments associated with high altitude hypoxia, adult Sprague Dawley male rats were exposed to simulated conditions of high altitude (7,500 m above sea level, 59 mmHg) for a period of 5 days and
Laurette Tavel et al.
PloS one, 7(4), e36187-e36187 (2012-05-05)
Human Phosphatidylethanolamine binding protein 1 (hPEBP1) also known as Raf kinase inhibitory protein (RKIP), affects various cellular processes, and is implicated in metastasis formation and Alzheimer's disease. Human PEBP1 has also been shown to inhibit the Raf/MEK/ERK pathway. Numerous reports

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique