Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

AV44127

Sigma-Aldrich

Anti-SLC39A12 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-FLJ30499, Anti-MGC43205, Anti-MGC51099, Anti-Solute carrier family 39 (Zinc transporter), member 12, Anti-bA570F3.1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

73 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_689938

Numéro d'accès UniProt

Q504Y0-3

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... SLC39A12(221074)

Catégories apparentées

Immunogène

Synthetic peptide directed towards the N terminal region of human SLC39A12

Application

Anti-SLC39A12 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.

Actions biochimiques/physiologiques

SLC39A12 (ZIP-12) is a zinc transporter protein that is predominantly expressed in brain. Zinc transporters are critical in the maintenance of cellular Zn+2 homeostasis. The expression of ZIP-12 is important for neurulation and development of the central nervous system. It mediates the neurite outgrowth and neuronal differentiation and is required for embryonic viability.

Séquence

Synthetic peptide located within the following region: MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVL

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Winyoo Chowanadisai et al.
Communicative & integrative biology, 6(6), e26207-e26207 (2014-02-26)
The essentiality of zinc for normal brain development is well established. It has been suggested that primary and secondary zinc deficiencies can contribute to the occurrence of numerous human birth defects, including many involving the central nervous system. In a
Winyoo Chowanadisai et al.
Proceedings of the National Academy of Sciences of the United States of America, 110(24), 9903-9908 (2013-05-30)
Zn(2+) is required for many aspects of neuronal structure and function. However, the regulation of Zn(2+) in the nervous system remains poorly understood. Systematic analysis of tissue-profiling microarray data showed that the zinc transporter ZIP12 (slc39a12) is highly expressed in
Mikael Klingeborn et al.
Scientific reports, 7(1), 4901-4901 (2017-07-09)
The retinal pigmented epithelium (RPE) forms the outer blood-retinal barrier in the eye and its polarity is responsible for directional secretion and uptake of proteins, lipoprotein particles and extracellular vesicles (EVs). Such a secretional division dictates directed interactions between the

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique