AV42290

Anti-AGR2 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-AG2, Anti-Anterior gradient homolog 2 (Xenopus laevis), Anti-GOB-4, Anti-HAG-2, Anti-XAG-2
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 20 kDa
• Espèces réactives: rat, dog, rabbit, human, bovine, horse, mouse, guinea pig
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunohistochemistry: suitable; western blot: suitable
• Numéro d'accès NCBI: NP_006399
• Numéro d'accès UniProt: O95994
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... AGR2(10551)

Description

Description générale

Anterior gradient homolog 2 (Xenopus laevis) (AGR2) is a protein disulfide isomerase (PDI) which aids protein folding and assembly by catalyzing formation and shuffling of cysteine disulfide bonds in the endoplasmic reticulum (ER). AGR2 is present in the ER of intestinal secretory epithelial cells and it is believed to have a role in mucin processing and colitis.

Spécificité

Anti-AGR2 antibody polyclonal antibody reacts with the bovine, chicken, zebrafish, human, mouse, and rat anterior gradient homolog 2 (Xenopus laevis).

Immunogène

Synthetic peptide directed towards the middle region of human AGR2

Application

Anti-anterior gradient homolog 2 (Xenopus laevis) polyclonal antibody is used to tag anterior gradient homolog 2 (Xenopus laevis) protein(s)/subunits for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques.

Actions biochimiques/physiologiques

AGR2 and hAG-3, human homologues of genes involved in differentiation, are associated with oestrogen receptor-positive breast tumours and interact with metastasis gene C4.4a and dystroglycan. Increased AGR2 expression is a valuable prognostic factor to predict the clinical outcome of the prostate cancer patients.

Séquence

Synthetic peptide located within the following region: AEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLY

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable