AV37882

Anti-HOXA3 (AB2) antibody produced in rabbit

IgG fraction of antiserum

• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: IgG fraction of antiserum
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 49 kDa
• Espèces réactives: mouse, human
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_034582
• Numéro d'accès UniProt: P02831
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Informations sur le gène: mouse ... HOXA3(15400)

Description

Description générale

HOX proteins are transcription factors involve in spatial and temporal order critical to body patterning (axial patterning) and limb development during embryonic development. HOXA3 promotes the differentiation of hematopoietic progenitor cells and is a cell mobilization/migration factor that supports angiogenesis, wound repair and aortic arch patterning and remodeling.

Spécificité

Anti-HOXA3 (AB2) polyclonal antibody reacts with mouse and rat Homeobox A3 proteins.

Immunogène

Synthetic peptide directed towards the N terminal region of mouse HOXA3

Application

Anti-HOXA3 (AB2) polyclonal antibody is used to tag the Homeobox A3 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of Homeobox A3 in angiogenesis and body pattern development during embryogenesis and wound repair.

Actions biochimiques/physiologiques

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. The HOXA3 gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation

Séquence

Synthetic peptide located within the following region: YDSSAIYGGYPYQAANGFAYNASQQPYAPSAALGTDGVEYHRPACSLQSP

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable