Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

AV34806

Sigma-Aldrich

Anti-ZNF627 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-Zinc finger protein 627

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

53 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... ZNF627(199692)

Description générale

ZNF627 codes for a zinc finger protein. ZNF627 polymorphisms are reportedly associated with the risk of myocardial infarction. Rabbit Anti-ZNF627 antibody recognizes human ZNF627.

Immunogène

Synthetic peptide directed towards the N terminal region of human ZNF627

Application

Rabbit Anti-ZNF627 antibody is suitable for western blot applications at a concentration of 0.125 μg/ml.

Actions biochimiques/physiologiques

Located on chromosome 19, this gene encodes for zinc finger protein 627.

Séquence

Synthetic peptide located within the following region: GKQWEDQNIEDPFKIPRRNISHIPERLCESKEGGQGEETFSQIPDGILNK

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 2

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Werner Koch et al.
International journal of cardiology, 147(1), 38-41 (2009-08-28)
A recent survey of 11,053 single nucleotide polymorphisms from 6891 genes suggested that the risk of myocardial infarction was related to specific genes so far not linked with atherosclerotic diseases. The genes encode the cytoskeletal protein palladin (PALLD), a receptor

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique