AV30649

Anti-MAP3K8 antibody produced in rabbit

IgG fraction of antiserum

• Synonyme(s) : Anti-Mitogen-activated protein kinase kinase kinase 8
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: IgG fraction of antiserum
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 53 kDa
• Espèces réactives: rat, dog, bovine, human, horse
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_005195
• Numéro d'accès UniProt: P41279
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... MAP3K8(1326)

Description

Description générale

Mitogen-activated protein kinase kinase kinase 8/mitogen-activated protein-3-kinase 8 (MAP3K8) activates MAP kinase and JNK kinase pathways, activates IkappaB kinases (IKK) and induces nuclear NF-kappaB. MAP3K8 promotes the production of TNA-α and IL-2 during T-cell activation.

Rabbit polyclonal anti-MAP3K8 antibody reacts with bovine, mouse, rat, canine, human, and chicken mitogen-activated protein kinase kinase kinase 8/mitogen-activated protein-3-kinase 8 kinases.

Immunogène

Synthetic peptide directed towards the C terminal region of human MAP3K8

Application

Rabbit Anti-MAP3K8 antibody can be used for western blot (2.5μg/ml) assays.

Rabbit polyclonal anti-MAP3K8 antibody is used to tag mitogen-activated protein kinase kinase kinase 8/mitogen-activated protein-3-kinase 8 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of mitogen-activated protein kinase kinase kinase 8/mitogen-activated protein-3-kinase 8 in MAP kinase and JNK kinase cell signaling.

Actions biochimiques/physiologiques

MAP3K8 is a member of the serine/threonine protein kinase family. This kinase can activate both the MAP kinase and JNK kinase pathways. This kinase was shown to activate IkappaB kinases, and thus induce the nuclear production of NF-kappaB. This kinase was also found to promote the production of TNF-alpha and IL-2 during T lymphocyte activation. Studies of a similar gene in rat suggested the direct involvement of this kinase in the proteolysis of NF-kappaB1,p105 (NFKB1). This gene may also utilize a downstream in-frame translation start codon, and thus produce an isoform containing a shorter N-terminus. The shorter isoform has been shown to display weaker transforming activity.

Séquence

Synthetic peptide located within the following region: PRCQSLDSALLERKRLLSRKELELPENIADSSCTGSTEESEMLKRQRSLY

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable