Accéder au contenu
Merck
Toutes les photos(1)

Documents

APREST79424

Sigma-Aldrich

PrEST Antigen AP2M1

Prestige Antigens Powered by Atlas Antibodies, buffered aqueous solution

Synonyme(s) :

AP50, CLAPM1, mu2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352202

Produit recombinant

expressed in E. coli

Pureté

>80% (SDS-PAGE)

Forme

buffered aqueous solution

Poids mol.

predicted mol wt 27 kDa

Produit purifié par

immobilized metal affinity chromatography (IMAC)

Concentration

≥0.5 mg/mL

Séquence immunogène

RMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC

Numéro d'accès Ensembl | humain

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... AP2M1(1173)

Description générale

Recombinant protein fragment of Human AP2M1 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.

Application

Suitable as a blocking agent using corresponding antibodies.

Liaison

Corresponding Antibody HPA036849.

Forme physique

Solution in 1 M urea-PBS, pH 7.4

Notes préparatoires

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Informations légales

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 2

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique