WH0000755M5

Monoclonal Anti-C21orf2 antibody produced in mouse

clone 1E4, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-A2, Anti-YF5, Anti-chromosome 21 open reading frame 2
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1E4, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable
• isotype: IgG2aκ
• GenBank accession no.: NM_004928
• UniProt accession no.: O43822
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... C21orf2(755)

Description

Immunogen

C21orf2 (NP_004919, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MKLTRKMVLTRAKASELHSVRKLNCWGSRLTDISICQEMPSLEVITLSVNSISTLEPVSRCQRLSELYLRRNRIPSLAELFYLKGLPRLRVLWLAENPCCG

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety Information

• Storage Class Code: 10 - Combustible liquids
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves