Skip to Content
Merck
All Photos(3)

Key Documents

SAB2100833

Sigma-Aldrich

Anti-c-Fos Antibody

rabbit polyclonal

Synonym(s):

Anti-C-fos, Anti-V-fos FBJ murine osteosarcoma viral oncogene homolog

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
CHF 473.00

CHF 473.00


Check Cart for Availability
A recombinant, preservative-free antibody is available for your target. Try ZRB457


Select a Size

Change View
100 μL
CHF 473.00

About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

CHF 473.00


Check Cart for Availability
A recombinant, preservative-free antibody is available for your target. Try ZRB457

Product Name

Anti-FOS antibody produced in rabbit, affinity isolated antibody

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

41 kDa

species reactivity

sheep, dog, human, mouse, bovine, rat, pig

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... FOS(2353)

Immunogen

Synthetic peptide directed towards the N terminal region of human FOS

Sequence

Synthetic peptide located within the following region: MFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCT

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Can Wang et al.
Frontiers in molecular neuroscience, 15, 812035-812035 (2022-03-19)
The reward of pain relief caused by acupuncture has been found to be clinically significant. However, the molecular mechanisms underlying acupuncture-induced reward of pain relief in chronic pain remain unclear and have not been analyzed in suitable preclinical models. Here
Adélaïde A Mohr et al.
Journal of cerebral blood flow and metabolism : official journal of the International Society of Cerebral Blood Flow and Metabolism, 41(7), 1734-1743 (2020-08-08)
The hypothalamus is the central regulator of energy homeostasis. Hypothalamic neuronal circuits are disrupted upon overfeeding, and play a role in the development of metabolic disorders. While mouse models have been extensively employed for understanding the mechanisms of hypothalamic dysfunction
Zhu Liu et al.
Acta biochimica et biophysica Sinica (2024-06-03)
Gastric cancer (GC) is a common gastrointestinal system malignancy. PACSIN1 functions as an oncogene in various cancers. This study aims to investigate the potential of PACSIN1 as a target in GC treatment. Gene expression is determined by RT-qPCR, immunofluorescence staining

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service