Skip to Content
Merck
All Photos(6)

Key Documents

HPA040642

Sigma-Aldrich

Anti-THRSP antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-LPGP1, Anti-Lpgp, Anti-S14, Anti-SPOT14, Anti-THRP

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
CHF 556.00

CHF 556.00


Estimated to ship on30 May 2025



Select a Size

Change View
100 μL
CHF 556.00

About This Item

MDL number:
UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

CHF 556.00


Estimated to ship on30 May 2025


biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

TYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMT

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... THRSP(7069)

General description

Thyroid hormone-inducible hepatic protein (THRSP) is also known as spot 14 protein. It is highly expressed in liver and mammary glands. The gene encoding THRSP enzyme is located on human chromosome 11q14.1. It is a 17 kDa protein and may function as homodimer.

Immunogen

thyroid hormone responsive recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-THRSP antibody produced in rabbit has been used in western blotting.

Biochem/physiol Actions

Thyroid hormone-inducible hepatic protein (THRSP) interacts with thyroid hormone receptor. The differential expression of THRSP in mesenchymal stem cells may contribute to deformity in spinal axis in Idiopathic scoliosis. THRSP modulates progression of breast cancer.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST80661

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Human spot 14 protein interacts physically and functionally with the thyroid receptor
Chou WY, et al.
Biochemical and Biophysical Research Communications, 357(1), 133-138 (2007)
Spot14/Spot14R expression may be involved in MSC adipogenic differentiation in patients with adolescent idiopathic scoliosis
Wang Q, et al.
Molecular Medicine Reports, 13(6), 4636-4642 (2016)
The ?Spot 14? gene resides on the telomeric end of the 11q13 amplicon and is expressed in lipogenic breast cancers: implications for control of tumor metabolism
Moncur JT, et al.
Proceedings of the National Academy of Sciences of the USA, 95(12), 6989-6994 (1998)
Human Spot 14 protein is a p53-dependent transcriptional coactivator via the recruitment of thyroid receptor and Zac1
Chou WY, et al.
The International Journal of Biochemistry & Cell Biology, 40(9), 1826-1834 (2008)
Expression, purification and preliminary crystallographic analysis of human thyroid hormone responsive protein
Zhang W, et al.
Acta Crystallographica. Section F, Structural Biology Communications, 67(8), 941-946 (2011)

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service