Skip to Content
Merck
All Photos(2)

Key Documents

AV41787

Sigma-Aldrich

Anti-ADH1B antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-ADH2, Anti-Alcohol dehydrogenase IB (class I), β polypeptide

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
CHF 354.00

CHF 354.00


Check Cart for Availability


Select a Size

Change View
100 μL
CHF 354.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

CHF 354.00


Check Cart for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

41 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ADH1B(125)

General description

Alcohol dehydrogenase-1B (ADH2) is an enzyme that metabolized a variety of substrates including ethanol, retinol, aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Alcohol dehydrogenase-1B is important in studies on alcoholism.

Specificity

Anti-alcohol dehydrogenase-1B (ADH2) reacts with the β-polypeptide of human alcohol dehydrogenase-1B.

Immunogen

Synthetic peptide directed towards the C terminal region of human ADH1B

Application

Anti-alcohol dehydrogenase-1B (ADH2) polyclonal antibody is used to tag alcohol dehydrogenase-1B protein(s)/subunits for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques.

Biochem/physiol Actions

ADH1B is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This protein, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism.The protein encoded by this gene is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This encoded protein, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster.

Sequence

Synthetic peptide located within the following region: NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Kshipra M Gharpure et al.
Oncotarget, 9(38), 25115-25126 (2018-06-05)
Primary debulking surgery followed by adjuvant chemotherapy is the standard treatment for ovarian cancer. Residual disease after primary surgery is associated with poor patient outcome. Previously, we discovered ADH1B to be a molecular biomarker of residual disease. In the current
Hui Li et al.
Toxicological sciences : an official journal of the Society of Toxicology, 164(2), 428-438 (2018-05-03)
Alcohol metabolism is a well-characterized biological process that is dominated by the alcohol dehydrogenase (ADH) and aldehyde dehydrogenase (ALDH) families. Nonalcoholic steatohepatitis (NASH) is the advanced inflammatory stage of nonalcoholic fatty liver disease (NAFLD) and is known to alter the

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service