HEXIM1 is induced by hexamethylene bis-acetamide. It co-ordinates with 7SK snRNAand subsequently inhibits P-TEFb (CDK9/Cyclin T) and RNA polymerase II. Rabbit Anti-HEXIM1 antibody recognizes bovine, human, mouse, rat, zebrafish, and canine HEXIM1.
Immunogen
Synthetic peptide directed towards the C terminal region of human HEXIM1
Application
Rabbit Anti-HEXIM1 antibody can be used for western blot applications at a concentration of 0.6 μg/ml.
Biochem/physiol Actions
HEXIM1 expression is induced by hexamethylene-bis-acetamide in vascular smooth muscle cells. The function of this protein is not yet known.
Sequence
Synthetic peptide located within the following region: LESKRLGGDDARVRELELELDRLRAENLQLLTENELHRQQERAPLSKFGD
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
The positive transcriptional elongation factor b (P-TEFb), consisting of CDK9 and cyclin T, stimulates transcription by phosphorylating RNA polymerase II. It becomes inactivated when associated with the abundant 7SK snRNA. Here, we show that the 7SK binding alone was not
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
