Skip to Content
Merck
All Photos(1)

Key Documents

AV32667

Sigma-Aldrich

Anti-INSM1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Insulinoma-associated 1

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
CHF 473.00

CHF 473.00


Check Cart for Availability


Select a Size

Change View
100 μL
CHF 473.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

CHF 473.00


Check Cart for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

53 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... INSM1(3642)

General description

INSM1 is a zinc finger protein that regulates neuroendocrine differentiation[1]. This protein is also known to repress the transcription of neuroD/b2 gene[2].
Rabbit Anti-INSM1 antibody recognizes human INSM1.

Immunogen

Synthetic peptide directed towards the C terminal region of human INSM1

Application

Rabbit Anti-INSM1 antibody can be used for western blot applications at a concentration of 0.5μg/ml.

Biochem/physiol Actions

The insulinoma-associated 1 (INSM1) gene is intronless and encodes a protein containing both a zinc finger DNA-binding domain and a putative prohormone domain. This gene is a sensitive marker for neuroendocrine differentiation of human lung tumors.

Sequence

Synthetic peptide located within the following region: LQAKGAPLAPPAEDLLALYPGPDEKAPQEAAGDGEGAGVLGLSASAECHL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Michael S Lan et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 23(7), 2024-2033 (2009-02-28)
Zinc-finger transcription factors are DNA-binding proteins that are implicated in many diverse biological functions. INSM1 (formerly IA-1) contains five zinc-finger motifs and functions as a transcription factor. INSM1 protein structure is highly conserved in homologues of different species. It is
Wei-Dong Liu et al.
The Biochemical journal, 397(1), 169-177 (2006-03-30)
INSM1/IA-1 (insulinoma-associated 1) is a developmentally regulated zinc-finger transcription factor, exclusively expressed in the foetal pancreas and nervous system, and in tumours of neuroendocrine origin. We have identified an INSM1 binding site in the neuroD/beta2 promoter and demonstrated transcriptional repressor

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service