AV44535

Anti-SDCBP antibody produced in rabbit

IgG fraction of antiserum

• Synonym(e): Anti-MDA-9, Anti-ST1, Anti-SYCL, Anti-Syndecan binding protein (syntenin), Anti-TACIP18
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: IHC, WB
• Citations: 4

Eigenschaften

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 32 kDa
• species reactivity: human, rat, rabbit, guinea pig, horse, mouse, bovine, dog
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable, western blot: suitable
• NCBI accession no.: NP_001007068
• UniProt accession no.: O00560
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SDCBP(6386)

Beschreibung

Immunogen

Synthetic peptide directed towards the middle region of human SDCBP

Application

Anti-SDCBP antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Biochem/physiol Actions

Syndecan binding protein (SDCBP; syntenin, mda-9) is a scaffolding protein containing a PDZ domain that has functions that include cell adhesion, proliferation, protein trafficking, cytoskeletal organization and activation of transcription factors. It promotes metastasis of cancer cells by activating FAK, NF-κB, c-Src and p38-MAPK pathways.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: VGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLV

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklasse: 10 - Combustible liquids
• Was ist los?: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable