SAB2102467

Anti-TMEM35 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-FLJ14084, Anti-Transmembrane protein 35
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 18 kDa
• species reactivity: guinea pig, human, rabbit, horse, mouse, bovine, rat
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• UniProt accession no.: Q53FP2
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... TMEM35(59353)

Description

General description

Transmembrane protein 35 (TMEM35) is mostly expressed in hypothalamic-pituitary-adrenal (HPA) circuitry and limbic areas, including the hippocampus and amygdala of mice. TMEM35 sis also known as the unknown factor-1(TUF-1). Human TMEM35 consists of 167 amino acids and is located at human chromosome Xq22.

Immunogen

Synthetic peptide directed towards the C terminal region of human TMEM35

Biochem/physiol Actions

Transmembrane protein 35 (TMEM35) is a multi-pass membrane protein. Any alteration in Transmembrane protein 35 (TMEM35) causes long term memory loss as well as impairs behavioral functions. TMEM35 regulates cell cycle progression and thereby modulates osteosarcoma cell growth, migration and invasion, making it a potent drug development target for therapeutics. In zona glomerulosa, the neurite outgrowth after sodium depletion is regulated by TMEM35.

Sequence

Synthetic peptide located within the following region: VFGILLTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable