Accéder au contenu

AV42455

Anti-ABHD5 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Abhydrolase domain containing 5, Anti-CDS, Anti-CGI58, Anti-IECN2, Anti-MGC8731, Anti-NCIE2

Se connecter pour consulter les tarifs organisationnels et contractuels.

Sélectionner une taille de conditionnement

Changer de vue

A propos de cet article

NACRES:
NA.41
UNSPSC Code:
12352203
Conjugate:
unconjugated
Clone:
polyclonal
Application:
WB
Citations:
3
Service technique
Besoin d'aide ? Notre équipe de scientifiques expérimentés est là pour vous.
Laissez-nous vous aider


biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

39 kDa

species reactivity

rabbit, dog, bovine, mouse, rat, sheep, human, horse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... ABHD5(51099)

General description

ABHD5/CGI58 product 1-acylglycerol-3-phosphate O-acyltransferase is a signaling agent that co-activates adipose triglyceride lipase and acylation of lysophosphatidic acid (LPA). ABHD5 (1-acylglycerol-3-phosphate O-acyl-transferase) is a member of the esterase/lipase/thioesterase subfamily that has been associated with a triglyceride storage disease involving impaired long-chain fatty acid oxidation, known as Chanarin-Dorfman syndrome, a rare neutral lipid disorder characterised by icthyosis, hepatic steatosis.

Immunogen

Synthetic peptide directed towards the N terminal region of human ABHD5

Application

Anti-ABHD5/CGI58 is a rabbit IgG polyclonal antibody used to tag comparative gene identification 58 (CGI58) proteins for detection and quantitation by Western blotting and in tissues by immunohistochemical (IHC) techniques.

Biochem/physiol Actions

ABHD5 belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in ABHD5 gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.The protein encoded by this gene belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.
Anti-ABHD5/CGI58 antibody reacts with a sequence of the enzyme human1-acylglycerol-3-phosphate O-acyltransferase.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: NRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALGLDKMILL

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

Essayez notre Outil de sélection de produits pour affiner vos choix.


Classe de stockage

10 - Combustible liquids

Que se passe-t-il ?

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable



Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents