SAB5702555

Anti-PER2 Antibody, clone 2K9Y0, Rabbit Monoclonal

• Synonyme(s) : FASPS, FASPS1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 2K9Y0, monoclonal
• Forme: liquid
• Poids mol.: 140 kDa
• Espèces réactives: mouse, mouse
• Concentration: 0.6 mg/mL
• Technique(s): ChIP: 1:50 - 1:200; immunofluorescence: 1:50 - 1:200; western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDDSGKELGMLVEPPDARQSPDTFSLMMAKSEHNPSTSGCSSD
• Numéro d'accès UniProt: O15055
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... PER2(8864)

Description

Description générale

This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene may increase the risk of getting certain cancers and have been linked to sleep disorders. [provided by RefSeq, Jan 2014]

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PER2 (O15055).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB, IF/ICC, ChIP

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1