Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

SAB2104121

Sigma-Aldrich

Anti-CHAC2, (N-terminal) antibody produced in rabbit

affinity isolated antibody

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

21 kDa

Espèces réactives

guinea pig, human, mouse, dog, rat, rabbit, bovine

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NM_001008708

Numéro d'accès UniProt

Q8WUX2

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... CHAC2(494143)

Catégories apparentées

Description générale

Glutathione-specific γ-glutamylcyclotransferase 2 (ChaC2) belongs to the ChaC family of γ-glutamylcyclotransferases. It carries a methionine (Met) residue at the N-terminus.

Immunogène

Synthetic peptide directed towards the N terminal region of human CHAC2

Application

Anti-CHAC2, (N-terminal) antibody produced in rabbit has been used in western blot.

Actions biochimiques/physiologiques

Glutathione-specific γ-glutamylcyclotransferase 2 (ChaC2) helps in degrading glutathione in the cytosol of mammals. In pathways that are independent of ChaC1, ChaC2 would disrupt the expression of nuclear erythroid-2-like factor (Nrf2) and glutamate cysteine ligase. Upregulation of ChaC2 gene can prevent the proliferation of cells. It may be considered as a candidate tumor suppressor gene (TSG) in gastrointestinal cancer.

Séquence

Synthetic peptide located within the following region: MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVV

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Yen T K Nguyen et al.
Biomolecules, 10(1) (2019-12-28)
Glutathione (GSH) degradation plays an essential role in GSH homeostasis, which regulates cell survival, especially in cancer cells. Among human GSH degradation enzymes, the ChaC2 enzyme acts on GSH to form 5-l-oxoproline and Cys-Gly specifically in the cytosol. Here, we
Shuiping Liu et al.
Cell death & disease, 8(8), e3009-e3009 (2017-08-25)
Tumor suppressor genes play a key role in cancer pathogenesis. Through massive expression profiling we identified CHAC2 as a frequently downregulated gene in gastric and colorectal cancers. Immunohistochemistry and western blot revealed that CHAC2 was downregulated in most tumor tissues
Amandeep Kaur et al.
The Journal of biological chemistry, 292(2), 638-651 (2016-12-04)
Glutathione degradation plays an important role in glutathione and redox homeostasis, and thus it is imperative to understand the enzymes and the mechanisms involved in glutathione degradation in detail. We describe here ChaC2, a member of the ChaC family of

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique