SAB1411909
ANTI-IL11 antibody produced in mouse
clone 3C6, purified immunoglobulin, buffered aqueous solution
Synonyme(s) :
AGIF, IL-11, IL11
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Produits recommandés
Source biologique
mouse
Conjugué
unconjugated
Forme d'anticorps
purified immunoglobulin
Type de produit anticorps
primary antibodies
Clone
3C6, monoclonal
Forme
buffered aqueous solution
Espèces réactives
human
Technique(s)
indirect ELISA: suitable
Isotype
IgG2bκ
Numéro d'accès UniProt
Conditions d'expédition
dry ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... IL11(3589)
Catégories apparentées
Description générale
The interleukin 11 (IL11) gene, with five exons spanning 7kb of genomic DNA, is mapped to human chromosome 19q13.42. The encoded protein belongs to the IL-6 family of cytokines. IL-11 is secreted by activated astrocytes.
The protein encoded by this gene is a member of the gp130 family of cytokines. These cytokines drive the assembly of multisubunit receptor complexes, all of which contain at least one molecule of the transmembrane signaling receptor IL6ST (gp130). This cytokine is shown to stimulate the T-cell-dependent development of immunoglobulin-producing B cells. It is also found to support the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells. (provided by RefSeq)
Immunogène
IL11 (NP_000632, 23 a.a.-199 a.a.) partial recombinant protein.
Sequence
GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Sequence
GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Actions biochimiques/physiologiques
Interleukin 11 (IL11) stimulates tumorigenesis in conjunction with angiogenesis of the primary tumor and of metastatic progenies at distant organs. IL-11 signaling is considered as a rate-limiting step for the tumorigenesis in the mucosa of the gastrointestinal tract. Thus, inhibition of IL-11 signaling can be considered as an emerging therapeutic strategy for various cancers. In addition, this protein also performs a protective role by increasing platelet recovery and inflammatory responses, in sepsis patients with thrombocytopenia. Mutation in the gene increases the risk of susceptibility to Hirschsprung disease and multiple sclerosis (MS).
Forme physique
Solution in phosphate buffered saline, pH 7.4
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
L H Kim et al.
Neurogastroenterology and motility : the official journal of the European Gastrointestinal Motility Society, 27(10), 1371-1377 (2015-07-15)
Hirschsprung disease (HSCR) is a congenital and heterogeneous disorder characterized by the absence of enteric ganglia during enteric nervous system (ENS) development. Our recent genome-wide association study has identified a variant (rs6509940) of interleukin-11 (IL-11) as a potential susceptible locus
IL-11 in multiple sclerosis.
Xin Zhang et al.
Oncotarget, 6(32), 32297-32298 (2015-10-10)
D McKinley et al.
Genomics, 13(3), 814-819 (1992-07-01)
The genomic sequence of human interleukin-11 (IL11) has been isolated based on its sequence homology with a cDNA clone encoding primate IL11. The human IL11 genomic sequence is 7 kb in length and consists of five exons and four introns.
Cameron N Johnstone et al.
Cytokine & growth factor reviews, 26(5), 489-498 (2015-07-27)
Interleukin (IL)-11 is a member of the IL-6 family of cytokines that is defined by the shared use of the GP130 signal transducing receptor subunit. In addition of its long recognized activities as a hemopoietic growth factor, IL-11 has an
Bing Wan et al.
Cytokine, 76(2), 138-143 (2015-08-16)
To examine the platelet recovering and anti-inflammatory effects of IL-11 in the treatment of sepsis, accompanied with thrombocytopenia and to investigate the associated mechanisms via a case-control study. 105 patients enrolled for the study were segregated into (1) IL-11 therapy
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique