Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

SAB1407792

Sigma-Aldrich

Anti-PDP2 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

KIAA1348

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~60 kDa

Espèces réactives

human

Technique(s)

western blot: 1 μg/mL

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PDP2(57546)

Description générale

Mouse polyclonal antibody raised against a full-length human PDP2 protein.
PDP2 (Pyruvate dehyrogenase phosphatase catalytic subunit 2) is a mitochondrial serine phos­phatase consisting of a catalytic subunit (PDP2c). It is a Mg2+ dependent enzyme. It has two active isoforms PDP 1 and 2. It is expressed in mammalian mitochondria.

Immunogène

PDP2 (NP_065837.1, 1 a.a. ~ 529 a.a) full-length human protein.

Sequence
MSSTVSYWILNSTRNSIATLQGGRRLYSRYVSNRNKLKWRLFSRVPPTLNSSPCGGFTLCKAYRHTSTEEDDFHLQLSPEQINEVLRAGETTHKILDLESRVPNSVLRFESNQLAANSPVEDRRGVASCLQTNGLMFGIFDGHGGHACAQAVSERLFYYVAVSLMSHQTLEHMEGAMESMKPLLPILHWLKHPGDSIYKDVTSVHLDHLRVYWQELLDLHMEMGLSIEEALMYSFQRLDSDISLEIQAPLEDEVTRNLSLQVAFSGATACMAHVDGIHLHVANAGDCRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMEDRLLGVLIPCRAFGDVQLKWSKELQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLVLASDGLWDMLSNEDVVRLVVGHLAEADWHKTDLAQRPANLGLMQSLLLQRKASGLHEADQNAATRLIRHAIGNNEYGEMEAERLAAMLTLPEDLARMYRDDITVTVVYFNSESIGAYYKGG

Application

Anti-PDP2 antibody produced in mouse is suitable for western blot analysis.

Actions biochimiques/physiologiques

PDP2 (Pyruvate dehyrogenase phosphatase catalytic subunit 2) is indirectly associated with glycolysis and the tricarboxylic acid cycle and fatty acid (FA) synthesis. It is an Mg2+ dependent enzyme. PDP2 is mainly involved in the activation of phosphorylated pyruvate dehydrogenase complex (PDC), which is an essential component for the stimulation of the oxidative decarboxylation of pyruvate.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Junko Kato et al.
Acta crystallographica. Section F, Structural biology and crystallization communications, 66(Pt 3), 342-345 (2010-03-09)
Pyruvate dehydrogenase phosphatase (PDP) is a mitochondrial serine phosphatase that activates phosphorylated pyruvate dehydrogenase complex by dephosphorylation. In humans, two PDP isoforms (1 and 2) have been identified. PDP1 is composed of a catalytic subunit (PDP1c) and a regulatory subunit
Mary C Sugden et al.
American journal of physiology. Endocrinology and metabolism, 284(5), E855-E862 (2003-04-05)
The mitochondrial pyruvate dehydrogenase complex (PDC) catalyzes the oxidative decarboxylation of pyruvate, linking glycolysis to the tricarboxylic acid cycle and fatty acid (FA) synthesis. Knowledge of the mechanisms that regulate PDC activity is important, because PDC inactivation is crucial for

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique