SAB1403521

Monoclonal Anti-ACTN4 antibody produced in mouse

clone 4D10, ascites fluid

• Synonyme(s) : ACTININ-4, DKFZp686K23158, FSGS, FSGS1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: ascites fluid
• Type de produit anticorps: primary antibodies
• Clone: 4D10, monoclonal
• Poids mol.: antigen ~38.21 kDa
• Espèces réactives: human, rat, mouse
• Technique(s): indirect ELISA: suitable; western blot: 1:500-1:1000
• Isotype: IgG2aκ
• Numéro d'accès NCBI: NM_004924
• Numéro d'accès UniProt: O43707
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... ACTN4(81)

Description

Description générale

Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in this gene have been associated with focal and segmental glomerulosclerosis. (provided by RefSeq)

Immunogène

ACTN4 (NP_004915, 592 a.a. ~ 701 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYK

Forme physique

Clear solution

Informations sur la sécurité

• Code de la classe de stockage: 11 - Combustible Solids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable