HPA025703

Anti-BLZF1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

• Synonyme(s) : Anti-Basic leucine zipper nuclear factor 1, Anti-Golgin-45, Anti-JEM-1, Anti-p45 basic leucine-zipper nuclear factor
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA025703
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Validation améliorée: recombinant expression; Learn more about Antibody Enhanced Validation
• Technique(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:20-1:50
• Séquence immunogène: KSLGHHKGEFLGQSEGVIEPNKELSEVKNVLEKLKNSERRLLQDKEGLSNQLRVQTEVNRELKKLLVASVGDDLQYHFERLARE
• Numéro d'accès UniProt: Q9H2G9
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... BLZF1(8548)

Description

Description générale

The gene BLZF1 (basic leucine zipper nuclear factor 1) is mapped to human chromosome 1q24. It belongs to the b-ZIP family of proteins. The encoded protein has a PEST (proline [P], glutamic acid [E], serine [S], and threonine [T]) motif, a putative leucine repeat and several phosphorylation sites. This protein is present in the nucleus, cytoplasm and Golgi apparatus.

Immunogène

Golgin-45 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Actions biochimiques/physiologiques

BLZF1 (basic leucine zipper nuclear factor 1) might work as a transcription factor. It is involved in epigenetic regulation by binding to DNMT3L (DNA methyltransferase 3 like) and also participates in Wnt/β-catenin signaling. The BLZF1 gene is downregulated in acute promyelocytic leukemia (APL) cell line NB4. On the other hand, it is upregulated in presence of dengue virus infection. BLZF1 also interacts with GRASP55 (the medial-Golgi matrix protein) and the GTP form of rab2. It is involved in the secretory protein transport and maintenance of the Golgi structure. This gene is downregulated in hepatocellular carcinoma. This low expression is associated with poor overall survival.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST76646

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable