HPA020765

Anti-NLRP2 antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-NACHT, LRR and PYD domains-containing protein 2, Anti-Nucleotide-binding site protein 1, Anti-PYRIN domain and NACHT domain-containing protein 1, Anti-PYRIN-containing APAF1-like protein 2
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA020765
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Technique(s): immunoblotting: 0.04-0.4 μg/mL
• Séquence immunogène: EVDKADGKQLVEILTTHCDSYWVEMASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDVDEMLERFKTEAQAFTETKGNVI
• Numéro d'accès UniProt: Q9NX02
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... NLRP2(55655)

Description

Description générale

The gene NLRP2 (NACHT, LRR and PYD domains-containing protein 2) is mapped to human chromosome 19q13.42. It belongs to the PAN (PYRIN and NACHT domain) family. NLRP2 is strongly expressed in lungs, placenta, and thymus. It is also referred as PAN1.

Immunogène

NACHT, LRR and PYD domains-containing protein 2 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Actions biochimiques/physiologiques

The expression of NLRP2 (NACHT, LRR and PYD domains-containing protein 2) is controlled by lipopolysaccharide (LPS) and interferons (IFNβ and IFNγ). In macrophages, NLRP2 inhibits activation of NF (nuclear factor)-κB and I(inhibitor)-κB kinases, and enhances caspase-1 activation and IL (Interleukin)-1β secretion. In astrocytes, NLRP2 inflammasome, a complex containing NLRP2, ASC (adaptor protein apoptosis-speck-like protein containing a caspase recruitment domain) and caspase-1, results in processing of inflammatory caspase-1 and IL-1β. Polymorphism in NLRP2 is associated with rheumatoid arthritis. Single nucleotide polymosrphism in NLRP2 is linked with arsenic-induced skin lesions, chromosomal damage and respiratory diseases.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST74231

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable