AV46034

Anti-IFIT3 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-CIG-49, Anti-GARG-49, Anti-IFI60, Anti-IFIT4, Anti-IRG2, Anti-ISG60, Anti-Interferon-induced protein with tetratricopeptide repeats 3, Anti-RIG-G
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 56 kDa
• Espèces réactives: human
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunohistochemistry: suitable; western blot: suitable
• Numéro d'accès NCBI: NP_001540
• Numéro d'accès UniProt: O14879
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... IFIT3(3437)

Description

Description générale

Interferon-induced protein with tetratricopeptide repeats 3 (IFIT3) is an interferon-stimulated gene induced by RNA virus infections, lipopolysaccharides and double-stranded RNA. IFIT3 and its family members (IFIT1, IFIT2, IFIT5) are involved in protein:protein interactions the a effect processes such as translation initiation, virus replication, cell migration, proliferation and ds-RNA signaling.

Spécificité

Anti-IFIT3 polyclonal antibody reacts with human, mouse, bovine, and rat interferon-induced protein with tetratricopeptide repeats 3 proteins.

Immunogène

Synthetic peptide directed towards the N terminal region of human IFIT3

Application

Anti-IFIT3 polyclonal antibody is used to tag interferon-induced protein with tetratricopeptide repeats 3 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and level of interferon-induced protein with tetratricopeptide repeats 3 in cells responding to interferon induction such as occurs during RNA virus infection.

Séquence

Synthetic peptide located within the following region: ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable