AV42122

Anti-TST antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-MGC19578, Anti-RDS, Anti-Thiosulfate sulfurtransferase (rhodanese)
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 33 kDa
• Espèces réactives: bovine, mouse, dog, human, rabbit, horse, rat
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunohistochemistry: suitable; western blot: suitable
• Numéro d'accès NCBI: NP_003303
• Numéro d'accès UniProt: Q16762
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... TST(7263)

Description

Description générale

Thiosulfate sulfurtransferase (rhodanese) (TST, RDS) is a mitochondrial matrix enzyme that facilitates the modification of sulfur-containing enzymes, and detoxification of H2S and cyanide. Thiosulfate sulfurtransferase converts cyanide into thiocyanide.

Spécificité

Anti-TST polyclonal antibody reacts with human, mouse, rat, bovine, canine, and chicken thiosulfate sulfurtransferase/rhodanese enzymes.

Immunogène

Synthetic peptide directed towards the middle region of human TST

Application

Anti-TST polyclonal antibody is used to tag thiosulfate sulfurtransferase/rhodanese for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of thiosulfate sulfurtransferase/rhodanese in hydrogen sulfide and cyanide detoxification.

Actions biochimiques/physiologiques

TST is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.The product of this gene is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The gene product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.

Séquence

Synthetic peptide located within the following region: GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable