Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

AV34285

Sigma-Aldrich

Anti-CORO1A (AB1) antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Coronin, actin binding protein, 1A

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

51 kDa

Espèces réactives

guinea pig, human, dog, bovine, rat, horse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_009005

Numéro d'accès UniProt

Q2YD73

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... CORO1A(11151)

Description générale

CORO1A is a WD-repeat protein that has been implicated in Mycobacterium leprae infection. Studies have reported that CORO1A localizes on the membrane of phagosomes that contain M. leprae, where Toll-like receptor (TLR) 2 is also present. CORO1A suppresses TLR-mediated signaling in human macrophages.
Rabbit Anti-CORO1A recognizes bovine, rat, rabbit, mouse, human, and canine CORO1A.

Immunogène

Synthetic peptide directed towards the C terminal region of human CORO1A

Application

Rabbit Anti-CORO1A can be used for western blot applications at a concentration of 1.25 μg/ml.

Actions biochimiques/physiologiques

CORO1A forms homodimers. It plays a role in the cross-linking of F-actin in the cell.

Séquence

Synthetic peptide located within the following region: TGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Koichi Suzuki et al.
Acta histochemica et cytochemica, 39(4), 107-112 (2007-03-01)
Mycobacteria have acquired an intracellular lifestyle within the macrophage, which is best exemplified by the enlarged infected histiocytes seen in lepromatous leprosy. To survive within the cell, mycobacteria must escape intracellular bactericidal mechanisms. In a study of Mycobacterium bovis Bacille
K Tanigawa et al.
Clinical and experimental immunology, 156(3), 495-501 (2009-05-15)
Mycobacterium leprae is an intracellular pathogen that survives within the phagosome of host macrophages. Several host factors are involved in producing tolerance, while others are responsible for killing the mycobacterium. Tryptophan aspartate-containing coat protein (TACO; also known as CORO1A or

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique