AV32479

Anti-NCOR1 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-Nuclear receptor co-repressor 1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 270 kDa
• Espèces réactives: mouse, dog, human, bovine
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunohistochemistry: suitable; western blot: suitable
• Numéro d'accès NCBI: NP_006302
• Numéro d'accès UniProt: Q60974
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... NCOR1(9611)

Description

Description générale

Nuclear receptor co-repressor 1/thyroid-hormone- and retinoic-acid-receptor-associated co-repressor 1 (NCOR1, TRAC-1) is a transcriptional coregulatory protein that recruits histone deacetylases to DNA promoter regions and assists nuclear receptors in the down regulation of RNA expression. NCOR1 controls thyroid hormone sensitivity and the set point of the hypothalamic-pituitary-thyroid axis. NCOR1 plays an adaptive role in muscle physiology.

Rabbit polyclonal anti-NCOR1 antibody reacts with human, canine, and mouse nuclear receptor co-repressor 1 transcriptional coregulatory proteins.

Immunogène

Synthetic peptide directed towards the N terminal region of human NCOR1

Application

Rabbit Anti-NCOR1 antibody can be used for western blot applications at a concentration of 0.5μg/ml.

Rabbit polyclonal anti-NCOR1 antibody is used to tag nuclear receptor co-repressor 1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of nuclear receptor co-repressor 1 in the hypothalamic-pituitary-thyroid axis regulation and muscle physiology.

Actions biochimiques/physiologiques

NCOR1 mediates ligand-independent transcription repression of thyroid-hormone and retinoic-acid receptors by promoting chromatin condensation and preventing access of the transcription machinery. It is part of a complex which also includes histone deacetylases and transcriptional regulators similar to the yeast protein Sin3p.

Séquence

Synthetic peptide located within the following region: NENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKK

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable