Skip to Content
Merck
All Photos(5)

Documents

AV32537

Sigma-Aldrich

Anti-POU2F3 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-POU domain, class 2, transcription factor 3

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

47 kDa

species reactivity

guinea pig, dog, rabbit, human, rat, sheep, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... POU2F3(25833)

General description

POU2F3, also known as Skn-1a and OCT11, gene is mapped to human chromosome 11q23.3. The gene codes for a keratinocyte-specific POU transcription factor. The protein is expressed in stratified squamous epithelia, including the epidermis, cervix and foreskin.

Immunogen

Synthetic peptide directed towards the N terminal region of human POU2F3

Application

Rabbit Anti-POU2F3 antibody can be used for western blotting applications at a concentration of 0.5μg/ml. It can also be used for IHC assays at 4-8μg/ml, using paraffin-embedded tissues.

Biochem/physiol Actions

POU2F3 is a transcription factor that is involved in the growth and differentiation of keratinocytes. Studies have reported that Pou2f3 (Skn-1a) is involved in the differentiation of chemosensory cells. Furthermore, this transcription factor is also required for specifying the lineage of taste receptor cells.

Sequence

Synthetic peptide located within the following region: KMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHR

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Monika I Hollenhorst et al.
Respiratory research, 24(1), 267-267 (2023-11-05)
Airway tuft cells, formerly called brush cells have long been described only morphologically in human airways. More recent RNAseq studies described a chemosensory cell population, which includes tuft cells, by a distinct gene transcription signature. Yet, until which level in
Makoto Ohmoto et al.
Bioscience, biotechnology, and biochemistry, 77(10), 2154-2156 (2013-10-08)
Solitary chemosensory cells in the non-neuronal epithelium of the anterior nasal cavity have bitter taste cell-like molecular characteristics and are involved in the detection of noxious substances. Here, we demonstrate that Pou2f3/Skn-1a, which is necessary for generation of sweet, umami
Ichiro Matsumoto et al.
Nature neuroscience, 14(6), 685-687 (2011-05-17)
Functional diversification of taste cells is crucial for proper discrimination of taste qualities. We found the homeodomain protein Skn-1a (Pou2f3) to be expressed in sweet, umami and bitter taste cells. Skn-1a-deficient mice lacked electrophysiological and behavioral responses to sweet, umami
Z Zhang et al.
Oncogene, 25(39), 5436-5445 (2006-04-12)
POU2F3 (OCT11, Skn-1a) is a keratinocyte-specific POU transcription factor whose expression is tied to squamous epithelial stratification. It is also a candidate tumor suppressor gene in cervical cancer (CC) because it lies in a critical loss of heterozygosity region on

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service