WH0051317M1

Monoclonal Anti-PHF21A antibody produced in mouse

clone 5A6, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-BHC80, Anti-BM006, Anti-KIAA1696, Anti-PHD finger protein 21A
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 5A6, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG1κ
• Numéro d'accès GenBank: NM_016621
• Numéro d'accès UniProt: Q96BD5
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... PHF21A(51317)

Description

Description générale

BHC80 is a component of a BRAF35 (MIM 605535)/histone deacetylase (HDAC; see MIM 601241) complex (BHC) that mediates repression of neuron-specific genes through the cis-regulatory element known as repressor element-1 (RE1) or neural restrictive silencer (NRS) (Hakimi et al., 2002 [PubMed 12032298]).[supplied by OMIM

Immunogène

PHF21A (NP_057705, 331 a.a. ~ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KQTVKSHTETDEKQTESRTITPPAAPKPKREENPQKLAFMVSLGLVTHDHLEEIQSKRQERKRRTTANPVYSGAVFEPERKKSAVTYLNSTMHPGTRKRA

Actions biochimiques/physiologiques

The gene PHF21A (PHD finger protein 21A) is also referred to as BHC80 and forms a component of the BRAF-histone deacetylase complex, which is involved in the repression of target-gene transcription. The encoded protein is found to be essential for normal brain development and cognitive function. Disruption of this gene has been found to be associated with developmental delay and craniofacial anomalies that are seen in patients with Potocki–Shaffer syndrome (PSS).

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): nwg
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)