Accéder au contenu
MilliporeSigma
Toutes les photos(4)

Principaux documents

WH0023327M4

Sigma-Aldrich

Monoclonal Anti-NEDD4L antibody produced in mouse

clone 1D2, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-KIAA0439, Anti-RSP5, Anti-hNedd42, Anti-neural precursor cell expressed, developmentally down-regulated 4-like

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

1D2, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... NEDD4L(23327)

Catégories apparentées

Description générale

The gene NEDD4L (neural precursor cell expressed, developmentally down-regulated 4-like) is mapped to human chromosome 18q21. The protein localizes in the cytoplasm.

Immunogène

NEDD4L (AAH32597, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLT

Actions biochimiques/physiologiques

NEDD4L (neural precursor cell expressed, developmentally down-regulated 4-like) is an ubiquitin ligase which is responsible for the ubiquitination and degradation of proteins. It causes ubiquitination of the TGF (transforming growth factor)-β membrane receptor, activated Smad (mothers against decapentaplegic homolog)-2/3 and inhibitory Smad7. NEDD4L-mediated ubiquitination of kidney epithelial sodium channels (ENaC) subunits plays an important role in hypertension control.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Go Kuratomi et al.
The Biochemical journal, 386(Pt 3), 461-470 (2004-10-22)
Inhibitory Smad, Smad7, is a potent inhibitor of TGF-beta (transforming growth factor-beta) superfamily signalling. By binding to activated type I receptors, it prevents the activation of R-Smads (receptor-regulated Smads). To identify new components of the Smad pathway, we performed yeast
Albert Escobedo et al.
Structure (London, England : 1993), 22(10), 1446-1457 (2014-10-09)
We investigated the mechanisms of activation and degradation of the E3 ubiquitin ligase Nedd4L combining the available biochemical information with complementary biophysical techniques. Using nuclear magnetic resonance spectroscopy, we identified that the C2 domain binds Ca(2+) and inositol 1,4,5-trisphosphate (IP3) using
Ran Zhao et al.
Nucleic acids research, 43(16), 7838-7849 (2015-07-02)
The expression of DNA damage-binding protein 2 (DDB2) has been linked to the prognosis of ovarian cancer and its underlying transcription regulatory function was proposed to contribute to the favorable treatment outcome. By applying gene microarray analysis, we discovered neural
H Chen et al.
European journal of human genetics : EJHG, 9(12), 922-930 (2002-02-13)
The validation of full-length cDNA represents a crucial step in gene identification and subsequent functional analysis. In searching for candidate genes for bipolar disorder on chromosome 18q21, a novel gene homologous to NEDD4 (Neural precursor cells expressed developmentally down-regulated) was
Fredrick J Rosario et al.
Clinical science (London, England : 1979), 130(7), 499-512 (2015-11-27)
Changes in placental amino acid transfer directly contribute to altered fetal growth, which increases the risk for perinatal complications and predisposes for the development of obesity, diabetes and cardiovascular disease later in life. Placental amino acid transfer is critically dependent

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique