Accéder au contenu
MilliporeSigma
Toutes les photos(3)

Key Documents

WH0011213M1

Sigma-Aldrich

Monoclonal Anti-IRAK3 antibody produced in mouse

clone 1A6, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-IRAKM, Anti-interleukin-1 receptor-associated kinase 3

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Numéro MDL:
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

1A6, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG1κ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... IRAK3(11213)

Description générale

Interleukin 1 receptor associated kinase 3 (IRAK3) belongs to the interleukin receptor associated kinase (IRAK) family that is capable of shuttling in and out of the nucleus. It is associated with monocytes and contains a kinase (homology) domain, signature death domain of the IRAK family, and a C-terminal domain. The IRAK3 gene is mapped to human chromosome 12q14.3.

Immunogène

IRAK3 (AAH57800, 497 a.a. ~ 596 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RIDRMTQKTPFECSQSEVMFLSLDKKPESKRNEEACNMPSSSCEESWFPKYIVPSQDLRPYKVNIDPSSEAPGHSCRSRPVESSCSSKFSWDEYEQYKKE

Actions biochimiques/physiologiques

Interleukin 1 receptor associated kinase 3 (IRAK3) acts as an anti-inflammatory molecule and blocks IRAK-4,-1 signaling. It is also negatively regulated toll-like receptor/interleukin (IL)-1 receptor (Toll/IL-R) immune signal transduction. IRAK3 may be involved in the pathophysiology of the hepatocellular carcinoma.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Sofia Dória et al.
BMC medical genomics, 13(1), 2-2 (2020-01-05)
12q14 microdeletion syndrome is characterized by low birth weight and failure to thrive, proportionate short stature and developmental delay. The opposite syndrome (microduplication) has not yet been characterized. Our main objective is the recognition of a new clinical entity -
Chih-Chi Kuo et al.
World journal of gastroenterology, 21(13), 3960-3969 (2015-04-09)
To examine the methylation levels of interleukin-1 receptor-associated kinase 3 (IRAK3) and GLOXD1 and their potential clinical applications in hepatocellular carcinoma (HCC). mRNA expression and promoter methylation of IRAK3 and GLOXD1 in HCC cells were analyzed by reverse transcription-polymerase chain
Degui Geng et al.
Communications biology, 3(1), 306-306 (2020-06-14)
Melanoma represents the most serious type of skin cancer. Although recent years have seen advances using targeted and immunotherapies, most patients remain at high risk for tumor recurrence. Here we show that IRAK-M, a negative regulator of MyD88 signaling, is
Morris Nechama et al.
Nature communications, 9(1), 1603-1603 (2018-04-25)
Interleukin 33 (IL-33) is among the earliest-released cytokines in response to allergens that orchestrate type 2 immunity. The prolyl cis-trans isomerase PIN1 is known to induce cytokines for eosinophil survival and activation by stabilizing cytokines mRNAs, but the function of
Lenuta Balaci et al.
American journal of human genetics, 80(6), 1103-1114 (2007-05-16)
Asthma is a multifactorial disease influenced by genetic and environmental factors. In the past decade, several loci and >100 genes have been found to be associated with the disease in at least one population. Among these loci, region 12q13-24 has

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique