WH0009842M1

Monoclonal Anti-PLEKHM1 antibody produced in mouse

clone 1C9, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-AP162, Anti-B2, Anti-KIAA0356, Anti-pleckstrin homology domain containing, family M (with RUN domain) member 1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 1C9, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): indirect ELISA: suitable
• Isotype: IgG2bκ
• Numéro d'accès GenBank: BC064361
• Numéro d'accès UniProt: Q9Y4G2
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... PLEKHM1(9842)

Description

Description générale

The protein encoded by this gene is essential for bone resorption, and may play a critical role in vesicular transport in the osteoclast. Mutations in this gene are associated with autosomal recessive osteopetrosis type 6 (OPTB6). Alternatively spliced transcript variants have been found for this gene. (provided by RefSeq)

Immunogène

PLEKHM1 (AAH64361, 957 a.a. ~ 1056 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PHRFSVADLQQIADGVYEGFLKALIEFASQHVYHCDLCTQRGFICQICQHHDIIFPFEFDTTVRCAECKTVFHQSCQAVVKKGCPRCARRRKYQEQNIFA

Actions biochimiques/physiologiques

PLEKHM1 (pleckstrin homology and RUN domain containing M1) is involved in the end stages of endocytic and autophagy pathways. Here, it interacts with RAB7 (member of RAS oncogene family), the HOPS (homotypic fusion and vacuole protein sorting) complex and ATG8 (autophagy-related protein 8) proteins. It plays an important role in autophagosome-lysosome fusion and endosome and autophagosome maturation. PLEKHM1 also participates in osteoclast function and bone resorption. In presence of Salmonella enterica Typhimurium, the PLEKHM1-RAB7-HOPS complex targets the Salmonella effector protein SifA (Salmonella-induced filament protein A) and controls vacuoles consisting of Salmonella.

Caractéristiques et avantages

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)