Accéder au contenu
MilliporeSigma
Toutes les photos(2)

Documents

WH0004240M9

Sigma-Aldrich

Monoclonal Anti-MFGE8 antibody produced in mouse

clone 3E9, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-BA46, Anti-EDIL1, Anti-HsT19888, Anti-OAcGD3S, Anti-milk fat globule-EGF factor 8 protein

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

3E9, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès GenBank

NM_005928

Numéro d'accès UniProt

Q08431

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... MFGE8(4240)

Description générale

Milk fat globule epidermal growth factor 8 (Mfge8) is a peripheral membrane soluble glycoprotein. It is liberated by several cells like macrophages. This protein is also termed as a phagocytosis “eat me” signal. It is predominantly expressed in lactating mammary glands.MFG-E8 has two-repeated EGF-like domains, a mucin-like domain, two-repeated discoidin-like domains (C-domains) and an integrin-binding motif (RGD sequence) in the EGF-like domain. This gene is located on human chromosome 15q26.

Immunogène

MFGE8 (NP_005919, 61 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
YAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFD

Actions biochimiques/physiologiques

Milk fat globule epidermal growth factor 8 (Mfge8) controls inflammation and immunity by mediating apoptotic cell clearance. It plays an important role in autoimmunity, neoangiogenesis and sperm-egg binding. Mfge8 also plays a major role in membrane vesicle secretion like budding or shedding of plasma membrane (microvesicles) and exocytosis of endocytic multivesicular bodies (exosomes).

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Mfge8 diminishes the severity of tissue fibrosis in mice by binding and targeting collagen for uptake by macrophages
Atabai K, et al.
The Journal of Clinical Investigation, 119(12), 3713-3722 (2009)
Mutation Identification for Epilepsy in the US Hispanic Population Using Whole-Ex- ome-Sequencing
Villanos M, et al.
HSOA Journal of Cell Biology and Cell Metabolism, 3(011) (2016)
Secretion of a peripheral membrane protein, MFG-E8, as a complex with membrane vesicles
Oshima K, et al.
European Journal of Biochemistry, 269(4), 1209-1218 (2002)
Fabiana N Soki et al.
The Journal of biological chemistry, 289(35), 24560-24572 (2014-07-10)
Tumor cells secrete factors that modulate macrophage activation and polarization into M2 type tumor-associated macrophages, which promote tumor growth, progression, and metastasis. The mechanisms that mediate this polarization are not clear. Macrophages are phagocytic cells that participate in the clearance

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique