The concentration of this antibody is typically 0.5 mg/mL. The lot specific value is reported in the Certificate of Analysis. Please see the link below to review a sample or lot specific Certificate:
https://www.sigmaaldrich.com/product/sigma/wh0001513m1#product-documentation
WH0001513M1
Monoclonal Anti-CTSK antibody produced in mouse
clone 2F1, purified immunoglobulin, buffered aqueous solution
Synonyme(s) :
Anti-CTS02, Anti-CTSO, Anti-CTSO1, Anti-CTSO2, Anti-MGC23107, Anti-PKND, Anti-PYCD, Anti-cathepsin K (pycnodysostosis)
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Sélectionner une taille de conditionnement
100 μG
718,00 $
718,00 $
Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.
Sélectionner une taille de conditionnement
Changer de vue
100 μG
718,00 $
About This Item
718,00 $
Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.
Produits recommandés
Source biologique
mouse
Niveau de qualité
Conjugué
unconjugated
Forme d'anticorps
purified immunoglobulin
Type de produit anticorps
primary antibodies
Clone
2F1, monoclonal
Forme
buffered aqueous solution
Espèces réactives
human
Technique(s)
indirect ELISA: suitable
western blot: 1-5 μg/mL
Isotype
IgG2aκ
Numéro d'accès GenBank
Numéro d'accès UniProt
Conditions d'expédition
dry ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... CTSK(1513)
Description générale
The protein encoded by this gene is a lysosomal cysteine proteinase involved in bone remodeling and resorption. This protein, which is a member of the peptidase C1 protein family, is predominantly expressed in osteoclasts. However, the encoded protein is also expressed in a significant fraction of human breast cancers, where it could contribute to tumor invasiveness. Mutations in this gene are the cause of pycnodysostosis, an autosomal recessive disease characterized by osteosclerosis and short stature. This gene may be subject to RNA editing. (provided by RefSeq)
Immunogène
CTSK (AAH16058, 220 a.a. ~ 329 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Sequence
KCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Actions biochimiques/physiologiques
Cathepsin K has a role in bone resorption and remodeling. It has a triple helical collagen hydrolase activity. Mutations in the gene encoding this protein have been linked to pycnodysostosis.
Forme physique
Solution in phosphate buffered saline, pH 7.4
Informations légales
GenBank is a registered trademark of United States Department of Health and Human Services
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Équipement de protection individuelle
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Faites votre choix parmi les versions les plus récentes :
Certificats d'analyse (COA)
Lot/Batch Number
Vous ne trouvez pas la bonne version ?
Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Joaquín Bobillo Lobato et al.
Medicina clinica, 145(7), 281-287 (2015-02-11)
Gaucher disease is an inherited disorder caused by deficit of acid β-glucocerebrosidase, responsible for the degradation of glucosylceramide to ceramide and glucose. Although the disorder is primarily hematologic, bone is the second most commonly affected structure. Cathepsin K (CATK) is
Xianglan Huang et al.
Calcified tissue international, 96(5), 373-378 (2015-03-03)
Pycnodysostosis is a rare autosomal recessive skeletal dysplasia characterized by short stature, osteosclerosis, acro-osteolysis, frequent fractures, and skull deformities. Mutation in the gene encoding cathepsin K (CTSK), which is a lysosomal cysteine protease, has been found to be responsible for
M S McQueney et al.
The Journal of biological chemistry, 272(21), 13955-13960 (1997-05-23)
The in vitro activation of the recombinant purified human cathepsin K (EC 3.4.22.38) was examined by mutagenesis. Cathepsin K was expressed as a secreted proenzyme using baculovirus-infected Sf21 insect cells. Spontaneous in vitro activation of procathepsin K occurred at pH
Adeleke H Aguda et al.
Proceedings of the National Academy of Sciences of the United States of America, 111(49), 17474-17479 (2014-11-26)
Cathepsin K is the major collagenolytic protease in bone that facilitates physiological as well as pathological bone degradation. Despite its key role in bone remodeling and for being a highly sought-after drug target for the treatment of osteoporosis, the mechanism
-
The antibody is in a buffered aqueous solution and one vial is 100ug, but what is the concentration and volume?
1 answer-
Helpful?
-
Active Filters
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique
