WH0000571M2

Monoclonal Anti-BACH1 antibody produced in mouse

clone 1B8, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-BTB and CNC homology 1, basic leucine zipper transcription factor 1
• Numéro MDL: MFCD06201924
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 1B8, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: mouse, human, rat
• Technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG2aκ
• Numéro d'accès GenBank: NM_206866
• Numéro d'accès UniProt: O14867
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... BACH1(571)

Description

Description générale

This gene encodes a transcription factor that belongs to the cap′n′collar type of basic region leucine zipper factor family (CNC-bZip). The encoded protein contains broad complex, tramtrack, bric-a-brac/poxvirus and zinc finger (BTB/POZ) domains, which is atypical of CNC-bZip family members. These BTB/POZ domains facilitate protein-protein interactions and formation of homo- and/or hetero-oligomers. When this encoded protein forms a heterodimer with MafK, it functions as a repressor of Maf recognition element (MARE) and transcription is repressed. Multiple alternatively spliced transcript variants have been identified for this gene. (provided by RefSeq)

Immunogène

BACH1 (NP_996749, 396 a.a. ~ 492 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HLAKGFWSDICSTDTPCQMQLSPAVAKDGSEQISQKRSECPWLGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQEPC

Caractéristiques et avantages

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)