SAB2108785

Anti-SIM1 antibody produced in rabbit HRP conjugated

affinity isolated antibody

• Synonyme(s) : 156DAG, A3a, AGRNR, DAG, MDDGA9
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.43

Propriétés

• Source biologique: rabbit
• Conjugué: peroxidase conjugate
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 85 kDa
• Réactivité de l'espèce (prédite par homologie): pig, bovine, canine, guinea pig, horse, rabbit, mouse, human
• Concentration: 0.5 mg/mL
• Technique(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): 4-8 μg/mL
• Numéro d'accès NCBI: NM_005068
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... SIM1(6493)

Description

Description générale

SIM1 and SIM2 genes are Drosophila single-minded (sim) gene homologs. SIM1 transcript was detected only in fetal kidney out of various adult and fetal tissues tested. Since the sim gene plays an important role in Drosophila development and has peak levels of expression during the period of neurogenesis,it was proposed that the human SIM gene is a candidate for involvement in certain dysmorphic features (particularly the facial and skull characteristics), abnormalities of brain development, and/or mental retardation of Down syndrome.

Immunogène

Synthetic peptide directed towards the middle region of Human SIM1

Séquence

Synthetic peptide located within the following region: SSSKSKSRTSPYPQYSGFHTERSESDHDSQWGGSPLTDTASPQLLDPADR

Forme physique

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 12 - Non Combustible Liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable