SAB2101237

Anti-KCTD7 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-FLJ32069, Anti-Potassium channel tetramerisation domain containing 7
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.43

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 33 kDa
• Espèces réactives: mouse, dog, horse, rabbit, bovine, human, pig, rat
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès UniProt: Q96MP8
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... KCTD7(154881)

Description

Immunogène

Synthetic peptide directed towards the N terminal region of human KCTD7

Actions biochimiques/physiologiques

The KCTD gene family, including KCTD7, encode predicted proteins that contain N-terminal domain that is homologous to the T1 domain in voltage-gated potassium channels (see KCNA1; MIM 176260). KCTD7 displays a primary sequence and hydropathy profile indicating intracytoplasmic localization. EST database analysis showed that KCTD7 is expressed in human and mouse brain.The KCTD gene family, including KCTD7, encode predicted proteins that contain N-terminal domain that is homologous to the T1 domain in voltage-gated potassium channels (see KCNA1; MIM 176260). KCTD7 displays a primary sequence and hydropathy profile indicating intracytoplasmic localization. EST database analysis showed that KCTD7 is expressed in human and mouse brain (Van Bogaert et al., 2007 [PubMed 17455289]).[supplied by OMIM].

Séquence

Synthetic peptide located within the following region: VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable