Accéder au contenu
MilliporeSigma
Toutes les photos(3)

Principaux documents

SAB1412447

Sigma-Aldrich

ANTI-HOXB7 antibody produced in mouse

clone 4C6, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

HHO.C1, HOX2, HOX2C, HOXB7, Hox-2.3

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
622,00 $

622,00 $

Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.
Toutes les photos(3)

Sélectionner une taille de conditionnement

Changer de vue
100 μG
622,00 $

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

622,00 $

Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

4C6, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen 33 kDa

Espèces réactives

human

Technique(s)

immunohistochemistry: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG1κ

Numéro d'accès NCBI

NM_004502

Numéro d'accès UniProt

P09629

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... HOXB7(3217)

Description générale

Homeobox B7 (HOXB7) is part of the HOX gene family and is expressed in embryonic tissues. The gene encoding it is localized on human chromosome 17q21.32.

Immunogène

HOXB7 (NP_004493, 55 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA

Actions biochimiques/physiologiques

Homeobox B7 (HOXB7) has a role in many cellular processes. It has been shown to be expressed in hepatocellular carcinoma. HOXB7 may also have a role in cell migration and invasion in gastric cancer. This transcription factor is vital for tissue differentiation and embryogenesis. HOXB7 may be a potential drug target in various cancers. The protein has the capacity to induce the expression of genes associated with tumor invasion and angiogenesis.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number
12174-S672
11326-4C6

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Rechercher un(e) COA

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

HOXB7-S3 inhibits the proliferation and invasion of MCF-7 human breast cancer cells.
Ma R
Molecular Medicine Reports, 12, 4901-4908 (2015)
Identification of several potential chromatin binding sites of HOXB7 and its downstream target genes in breast cancer.
Heinonen H
International Journal of Cancer. Journal International Du Cancer, 137, 2374-2383 (2015)
The roles of HOXB7 in promoting migration, invasion, and anti-apoptosis in gastric cancer.
Joo MK, et.al.
Journal of Gastroenterology and Hepatology, 31, 1717-1726 (2016)
Serologic analysis of ovarian tumor antigens reveals a bias toward antigens encoded on 17q.
Stone B
International Journal of Cancer. Journal International Du Cancer, 104, 73-84 (2003)
Xingang Zhou et al.
Frontiers in cell and developmental biology, 9, 697086-697086 (2021-08-31)
Diffuse glioma is the most common primary tumor of the central nervous system. The prognosis of the individual tumor is heavily dependent on its grade and subtype. Homeobox B7 (HOXB7), a member of the homeobox family, is abnormally overexpressed in
Afficher tous les articles scientifiques apparentés

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique