Accéder au contenu
MilliporeSigma
Toutes les photos(2)

Principaux documents

SAB1406878

Sigma-Aldrich

Anti-KIAA0101 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

L5, NS5ATP9, OEATC-1, OEATC1, PAF, p15(PAF)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~12.32 kDa

Espèces réactives

human

Technique(s)

immunofluorescence: suitable
western blot: 1 μg/mL

Numéro d'accès NCBI

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... KIAA0101(9768)

Description générale

KIAA0101, also known as, proliferating cell nuclear antigen (PCNA) clamp associated factor (PCLAF), is a proliferating cell nuclear antigen-associated factor. It is a 15kDa protein. It is highly expressed in thymus and colon. KIAA0101 gene is located on the human chromosome 15q22.31.

Immunogène

KIAA0101 (NP_055551.1, 1 a.a. ~ 111 a.a) full-length human protein.

Sequence
MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE

Actions biochimiques/physiologiques

KIAA0101, also known as, proliferating cell nuclear antigen (PCNA) clamp associated factor (PCLAF), helps in regulating DNA repair, cell cycle progression and cell proliferation. Overexpression of KIAA0101 inhibits UV-induced cell death. It is also used as a prognostic marker for hepatocellular carcinoma(HCC). Overexpression of KIAA0101 acts as a marker for adrenocortical carcinoma (ACC) and human gastric cancer.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Gene expression profiling of Japanese psoriatic skin reveals an increased activity in molecular stress and immune response signals
Kulsk JK, et al.
Journal of Molecular Medicine, 83(12), 964-975 (2005)
KIAA0101 is overexpressed, and promotes growth and invasion in adrenal cancer
Jain M, et al.
PLoS ONE, 6(11), e26866-e26866 (2011)
Overexpression of KIAA0101 predicts high stage, early tumor recurrence, and poor prognosis of hepatocellular carcinoma
Yuan RH, et al.
Clinical Cancer Research, 13(18), 5368-5376 (2007)
Kun Zhu et al.
Cancer science, 104(3), 353-359 (2012-12-18)
Gastric cancer (GC) is one of the most common malignant tumors with a high rate of recurrence, which results in surgery being unsuccessful. Therefore, it is important to find the reason for the surgery failing. The purpose of the present

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique