Accéder au contenu
MilliporeSigma
Toutes les photos(3)

Principaux documents

SAB1403498

Sigma-Aldrich

Monoclonal Anti-ANKRD37 antibody produced in mouse

clone 6E8, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Lrp2bp, MGC111507

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
639,00 $

639,00 $


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.


Sélectionner une taille de conditionnement

Changer de vue
100 μG
639,00 $

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

639,00 $


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

6E8, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~43.9 kDa

Espèces réactives

human

Technique(s)

capture ELISA: suitable
immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

Description générale

Ankyrin repeat domain 37 (ANKRD37) is a protein containing ankyrin repeats (ARs) and a nuclear localization signal (NLS). The protein is expressed in human testis, small intestine, colon, blood leukocytes and human pancreatic adenocarcinoma cells. The gene is located on human chromosome 4q35.1.

Immunogène

ANKRD37 (NP_859077.1, 1 a.a. ~ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHKAAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRKC

Actions biochimiques/physiologiques

Ankyrin repeat domain 37 (ANKRD37) is important in protein-protein interactions and signalling pathways. It acts as a target gene for hypoxia-inducible factor 1 (HIF-1).

Forme physique

Solution in phosphate buffered saline, pH 7.4

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Mouse Fem1b interacts with and induces ubiquitin-mediated degradation of Ankrd37
Shi YQ, et al.
Gene, 485(2), 153-159 (2011)
An integrative genomics approach identifies Hypoxia Inducible Factor-1 (HIF-1)-target genes that form the core response to hypoxia
Benita Y, et al.
Nucleic Acids Research, 37(14), 4587-4602 (2009)
Molecular cloning and characterization of a novel human gene containing 4 ankyrin repeat domains
Li J, et al.
Cellular & Molecular Biology Letters, 10(1), 185-193 (2005)
Analysis of loss of heterozygosity on chromosome 4q in hepatocellular carcinoma using high-throughput SNP array
Zhang H, et al.
Oncology Reports, 23(2), 445-455 (2010)

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique