Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Principaux documents

SAB1403423

Sigma-Aldrich

Monoclonal Anti-SCGB3A1 antibody produced in mouse

clone 3G5, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

HIN-1, HIN1, LU105, MGC87867, PnSP-2, UGRP2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

3G5, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~37.55 kDa

Espèces réactives

human

Technique(s)

capture ELISA: suitable
indirect ELISA: suitable

Isotype

IgG2aκ

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SCGB3A1(92304)

Description générale

Secretoglobin family 3A member 1 (SCGB3A1) is a member of secretoglobin gene super family, which contains small secretory proteins. SCGB3A1 is expressed mainly in the epithelial organs, such as the lungs, breast glands, trachea, prostate and salivary glands. SCGB3A1 gene is located on human chromosome 5q35.3.

Immunogène

SCGB3A1 (AAH29176, 1 a.a. ~ 104 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MKLAALLGLCVALSCSSAAAFLVGSAKPVAQPVAALESAAEAGAGTLANPLGTLNPLKLLLSSLGIPVNHLIEGSQKCVAELGPQAVGAVKALKALLGALTVFG

Actions biochimiques/physiologiques

Secretoglobin family 3A member 1 (SCGB3A1) plays an important role in cell growth, migration and invasion as a potent inhibitor and these activities are mediated through protein kinase B (PKB/AKT) signal pathway. Aberrant mutations of SCGB3A1 may be used as a prognostic marker for breast cancer and other human malignancies. SCGB3A1 is used as an epigenetic marker for therapy selection in glioblastoma multiforme (GBM). SCGB3A1 plays an important role in inflammation.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Aberrant methylation of HIN-1 (high in normal-1) is a frequent event in many human malignancies
Shigematsu H, et al.
International Journal of Cancer. Journal International Du Cancer, 113(4) (2005)
High-resolution genome-wide analysis of chromosomal alterations in elastofibroma
Hernandez J L G , et al.
Virchows Archiv, 456(6) (2010)
Regulation of mouse Scgb3a1 gene expression by NF-Y and association of CpG methylation with its tissue-specific expression
Tomita T, et al.
BMC Molecular Biology, 9(1), 5-5 (2008)
Aberrant promoter methylation of HIN-1 gene may contribute to the pathogenesis of breast cancer: a meta-analysis
Dai D, et al.
Tumour Biology : the Journal of the International Society For Oncodevelopmental Biology and Medicine, 35(8) (2014)
HIN-1: a New Epigenetic Biomarker Crucial for Therapy Selection in Glioblastoma Multiforme
Herranz M, et al.
Molecular Neurobiology, 53(3) (2016)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique