Accéder au contenu
MilliporeSigma
Toutes les photos(2)

Principaux documents

SAB1403138

Sigma-Aldrich

Monoclonal Anti-SLC7A8, (C-terminal) antibody produced in mouse

clone 3F10, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

LAT2, LPI-PC1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
639,00 $

639,00 $

Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.
Toutes les photos(2)

Sélectionner une taille de conditionnement

Changer de vue
100 μG
639,00 $

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

639,00 $

Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Source biologique

mouse

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

3F10, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~33.7 kDa

Espèces réactives

human

Technique(s)

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès NCBI

NM_012244

Numéro d'accès UniProt

Q9UHI5

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SLC7A8(23428)

Catégories apparentées

Description générale

Solute carrier family 7 member 8 (SLC7A8), also known as L-amino acid transporter-2 (LAT-2), is part of the amino acid transporters family. It is a subunit of the heavy chain of the surface antigen 4F2 (4F2hc). The protein is expressed in the placenta and fetal capillaries. The SLC7A8 gene is localized on human chromosome 14q11.2.

Immunogène

SLC7A8 (NP_036376.2, 467 a.a. ~ 535 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VYWQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKDKDVAGQPQP

Actions biochimiques/physiologiques

Solute carrier family 7 member 8 (SLC7A8) is involved in amino acid transport.It has a role in absorption of neutral amino acids in the kidney. Mutations in the gene encoding this protein have been linked to lysinuric protein intolerance.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number
08193-3F10

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Rechercher un(e) COA

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Expression and functional characterisation of System L amino acid transporters in the human term placenta.
Gaccioli F
Reproductive Biology and Endocrinology (2015)
Identification of a membrane protein, LAT-2, that Co-expresses with 4F2 heavy chain, an L-type amino acid transport activity with broad specificity for small and large zwitterionic amino acids.
Pineda M
The Journal of Biological Chemistry (1999)
Reabsorption of neutral amino acids mediated by amino acid transporter LAT2 and TAT1 in the basolateral membrane of proximal tubule.
Park SY
Archives of Pharmacal Research (2005)
SLC7A7, encoding a putative permease-related protein, is mutated in patients with lysinuric protein intolerance.
Borsani G
Nature Genetics (1999)
Wen Deng et al.
Nature communications, 11(1), 304-304 (2020-01-18)
Biological processes in development and disease are controlled by the abundance, localization and modification of cellular proteins. We have developed versatile tools based on recombinant E3 ubiquitin ligases that are controlled by light or drug induced heterodimerization for nanobody or
Afficher tous les articles scientifiques apparentés

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique