Accéder au contenu
MilliporeSigma
Toutes les photos(5)

Principaux documents

SAB1402127

Sigma-Aldrich

Monoclonal Anti-BDNF antibody produced in mouse

clone 1B10, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

MGC34632

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
710,00 $

710,00 $


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.
Un anticorps recombinant, sans conservateur, est disponible pour votre cible. Essayez ZRB1136


Sélectionner une taille de conditionnement

Changer de vue
100 μG
710,00 $

About This Item

Numéro MDL:
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.43

710,00 $


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.
Un anticorps recombinant, sans conservateur, est disponible pour votre cible. Essayez ZRB1136

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

1B10, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~53.28 kDa

Espèces réactives

human

Technique(s)

immunofluorescence: suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... BDNF(627)

Description générale

The brain derived neurotrophic factor (BDNF) gene is mapped to human chromosome 11p14.1.
The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer′s and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene. (provided by RefSeq)

Immunogène

BDNF (AAH29795, 1 a.a. ~ 247 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHMIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYKTKCNPMGYAKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Application

Monoclonal Anti-BDNF antibody produced in mouse has been used in western blotting.

Actions biochimiques/physiologiques

Brain derived neurotrophic factor (BDNF) is involved in hippocampal function and verbal episodic memory in humans. Variation in the BDNF gene expression alters these neurological functions. BDNF also plays a vital role in vascular function and participates in angiogenesis via the specific receptor tropomyosin-related kinase B (TrkB). ProBDNF interacts with the p75 neurotrophin receptor, leading to long-term depression in the hippocampus.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Mohammad Torabi-Nami et al.
EXCLI journal, 12, 347-372 (2013-01-01)
Experimentally-induced total sleep deprivation (TSD) and chronic partial sleep restriction (CPSR) leads to the emergence of cognitive impairments. This is hypothesized to result from a consequent neuroinflammation which may also hasten the neurodegenerative processes. Neuroinflammatory markers such as tumor necrosis
Peripheral vascular reactivity and serum BDNF responses to aerobic training are impaired by the BDNF Val66Met polymorphism.
Lemos JR Jr, et al.
Physiological Genomics, 48(2), 116-123 (2015)
The BDNF val66met polymorphism affects activity-dependent secretion of BDNF and human memory and hippocampal function.
Egan MF, et al.
Cell, 112(2), 257-269 (2003)
11p14. 1 microdeletions associated with ADHD, autism, developmental delay, and obesity.
Shinawi M, et al.
American Journal of Medical Genetics. Part A, 155(6), 1272-1280 (2011)
Electroacupuncture at the Baihui acupoint alleviates cognitive impairment and exerts neuroprotective effects by modulating the expression and processing of brain-derived neurotrophic factor in APP/PS1 transgenic mice.
Lin R
Molecular Medicine Reports, 13(2), 1611-1617 (2016)

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique