SAB1401412
Monoclonal Anti-MYST3 antibody produced in mouse
clone 4D8, purified immunoglobulin, buffered aqueous solution
Synonyme(s) :
KAT6A, MGC167033, MOZ, RUNXBP2, ZNF220
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Source biologique
mouse
Conjugué
unconjugated
Forme d'anticorps
purified immunoglobulin
Type de produit anticorps
primary antibodies
Clone
4D8, monoclonal
Forme
buffered aqueous solution
Espèces réactives
human
Technique(s)
capture ELISA: suitable
western blot: 1-5 μg/mL
Isotype
IgG2bκ
Numéro d'accès NCBI
Conditions d'expédition
dry ice
Température de stockage
−20°C
Informations sur le gène
human ... MYST3(7994)
Description générale
MOZ (monocytic leukemia zinc finger protein) is also known as lysine acetyltransferase 6 (KAT6A) and belongs to the MYST (MOZ, YBF2/SAS3, SAS2 and TIP60) family. The KAT6 gene is mapped to human chromosomes 8p11.21.{87] The structure of KAT6 is evolutionarily conserved in organisms ranging from yeast to mammals. The encoded protein contains a nuclear localization domain (including H15), a histone-acetyltransferase domain (HAT), an acidic glutamate/aspartate-rich region, a double-plant homeodomain finger that interacts with acetylated histone H3 tails (PHD 1 and 2) and a serine and methionine-rich region containing a transactivation domain. In humans, the gene is broadly expressed in different tissues, strongly in the brain and to a lesser extent in the heart.
Immunogène
MYST3 (NP_006757, 81 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKSIERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGK
Sequence
ALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKSIERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGK
Actions biochimiques/physiologiques
KAT6A (lysine acetyltransferase 6A) is a histone acetyltransferase.{87] It is a transcriptional co-activator. It acetylates histone H3 at K14 and K9 and H4 at K5, K8, K12 and K16 in vitro. KAT6A is associated with the regulation of cell cycle and stem cell homeostasis. In acute myeloid leukemia, the involvement of KAT6A along with CREB binding protein has been observed. KAT6A acts as an oncogene. Mutations and abnormal regulation in KAT6 gene is associated with solid tumors and developmental disorders in human. It serves as a key epigenetic regulator of hematopoiesis. Mutations in the gene lead to abnormal acetylation of K9 and K18 of histone3 as well as changes in the P53 signaling. Therefore, affecting multiple cellular processes and controlling disease conditions.
Forme physique
Solution in phosphate buffered saline, pH 7.4
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
12 - Non Combustible Liquids
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Faites votre choix parmi les versions les plus récentes :
Certificats d'analyse (COA)
Lot/Batch Number
Vous ne trouvez pas la bonne version ?
Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Dominant mutations in KAT6A cause intellectual disability with recognizable syndromic features.
Tham E
American Journal of Human Genetics, 96(3), 507-513 (2015)
De novo nonsense mutations in KAT6A, a lysine acetyl-transferase gene, cause a syndrome including microcephaly and global developmental delay.
Arboleda VA
American Journal of Human Genetics, 96(3), 498-506 (2015)
Regulation of KAT6 Acetyltransferases and Their Roles in Cell Cycle Progression, Stem Cell Maintenance, and Human Disease.
Huang F
Molecular and Cellular Biology, 36(14), 1900-1907 (2016)
Selective recognition of histone crotonylation by double PHD fingers of MOZ and DPF2.
Xiong X
Nature Chemical Biology, 12(12), 1111-1118 (2016)
Brittany Turner-Ivey et al.
Neoplasia (New York, N.Y.), 16(8), 644-655 (2014-09-16)
The chromosome 8p11-p12 amplicon is present in 12% to 15% of breast cancers, resulting in an increase in copy number and expression of several chromatin modifiers in these tumors, including KAT6A. Previous analyses in SUM-52 breast cancer cells showed amplification
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique