Accéder au contenu
MilliporeSigma
Toutes les photos(6)

Principaux documents

HPA043083

Sigma-Aldrich

Anti-PLA2G4C antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-Cpla2-γ, Anti-Phospholipase a2, group ivc (cytosolic, calcium-independent)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
757,00 $

757,00 $


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.


Sélectionner une taille de conditionnement

Changer de vue
100 μL
757,00 $

About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

757,00 $


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

Séquence immunogène

EAELDLWSKAPASCYILKGETGPVVMHFPLFNIDACGGDIEAWSDTYDTFKLADTYTLDVVVLLLALAKKNVRENKKKILRELMNVAGLYYPKD

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PLA2G4C(8605)

Description générale

The gene PLA2G4C (phospholipase A2 group IVC) is mapped to human chromosome 19. The encoded protein belongs to the phospholipase A2 family of proteins. PLA2G4C is mainly expressed in the brain, heart and skeletal muscle. The protein is present in the endoplasmatic reticulum and mitochondria.

Immunogène

phospholipase A2, group IVC (cytosolic, calcium-independent) recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-PLA2G4C antibody produced in rabbit has been used in western blotting, immunofluorescence and immunoprecipitation.

Actions biochimiques/physiologiques

PLA2G4C (phospholipase A2 group IVC) is responsible for the release of fatty acids from phospholipids. It plays an important role in the generation of prostaglandins and remodeling of cellular membrane. Cytoplasmic PLA2G4C participates in arachidonic acid metabolism. PLA2G4C also exhibits lysophospholipase and transacylation activity. Mutation in this gene, rs1549637 (T>A), might be associated with the susceptibility to schizophrenia. Polymorphism in this gene controls the disease outcome in patients with colorectal cancer. It is also involved in the chemotaxis of breast cancer cells. Silencing of this gene suppresses EGF (epidermal growth factor)-mediated chemotaxis in breast cancer cell lines. PLA2G4C variants can increase the levels of prostaglandins, thereby influencing preterm birth risk.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST82579

Forme physique

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Prognostic significance of PLA2G4C gene polymorphism in patients with stage II colorectal cancer.
Olsen RS, et al.
Acta Oncologica (Stockholm, Sweden), 55, 474-479 (2016)
Primate-specific evolution of noncoding element insertion into PLA2G4C and human preterm birth.
Plunkett J, et al.
BMC Medical Genomics, 3, 62-62 (2010)
Downregulation of cPLA2? expression inhibits EGF-induced chemotaxis of human breast cancer cells through Akt pathway.
Tian G, et al.
Biochemical and Biophysical Research Communications, 409, 506-512 (2011)
Ewa Pniewska-Dawidczyk et al.
International journal of immunopathology and pharmacology, 35, 2058738421990952-2058738421990952 (2021-02-26)
Chronic inflammation in asthmatics is initiated/exacerbated by many environmental factors, such as bacterial lipopolysaccharide and allergens. Phospholipase A2 and histone acetyltransferase/deacetylases are enzymes involved in inflammatory process, particularly in lipid inflammatory mediators production and control of transcription of many inflammatory
Cytosolic phospholipase A2 gamma is involved in hepatitis C virus replication and assembly.
Xu S, et al.
Journal of Virology, 86, 13025-13037 (2012)

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique