HPA039255

Anti-NPAS4 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-BHLHe79, Anti-Le-PAS, Anti-NXF, Anti-Neuronal PAS domain protein 4, Anti-PASD10
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA039255
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Technique(s): immunohistochemistry: 1:50- 1:200
• Séquence immunogène: YLTFPSGPEPSLQAELSKDLVCTPPYTPHQPGGCAFLFSLHEPFQTHLPTPSSTLQEQLTPSTATFSDQLTPSSATFPDPLTSPLQGQLTETS
• Numéro d'accès UniProt: Q8IUM7
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... NPAS4(266743)

Description

Description générale

The gene NPAS4 (neuronal PAS domain protein 4) is mapped to human chromosome 11q13. It is also referred to as NXF (neuronal transcription factor) and LE-PAS (limbic-enriched PAS domain protein). The encoded protein belongs to the basic helix-loop-helix (bHLH)-PAS (Per-ARNT-Sim) protein family. NPAS4 is mainly expressed in the brain and low levels are also present in the testis. The protein is present in the nucleus.
NPAS4 protein interacts with:

• ARNT (anti-ARNT HPA001759)
• ARNTL (anti-ARNTL SAB4300614)
• ARNT2 (anti-ARNT2 HPA001056)

Immunogène

neuronal PAS domain protein 4 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.
Anti-NPAS4 antibody produced in rabbit has been used in western blotting.

Actions biochimiques/physiologiques

NPAS4 (neuronal PAS domain protein 4) is an activity-related transcription factor. It controls inhibitory and excitatory synapse formation. This action of NPAS4 depends on the neuronal cell type. NPAS4 also regulates the expression of brain-derived neurotrophic factor (BDNF), a neurotrophin required for neuronal viability, differentiation and synaptic plasticity. NPAS4 is associated with cognitive and social neurobehavior. In addition, it is involved in hippocampus- and amygdala-linked learning and memory. NPAS4 is also linked with psychiatric disorders, including bipolar disorder, autism spectrum disorder and cognition-associated disorders. This gene is also expressed during ischemic stroke and protects neurons against neurodegenerative insults.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST80909

Forme physique

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable